compare

Comparison List

mEos4Fast2

a.k.a. mEos4b-T59Q-L93M

mEos4Fast2 is a photoconvertible red fluorescent protein published in 2025, derived from Lobophyllia hemprichii. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.9 kDa -

FPbase ID: 9KH59

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 499 513 78,020 0.82 63.98 4.9 27.0  
Red 565 580 43,290 0.54 23.38 5.4    
Edit state transitions

Photostability

No photostability measurements available ... add one!

mEos4Fast2 Sequence

mEos4Fast2 was derived from mEos4b-L93M with the following mutations: T59Q
amino acid numbers relative to EosFP. show relative to mEos4b-L93M

MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQTMDLEVKEGGPLPFAFDILTQAFHYGNRVFVKYPDNIQDYFKQSFPKGYSWERSMTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHAIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

In contrast, the T59Q mutation significantly improved the apparent maturation time, particularly in the variant mEos4b-T59Q-L93M, which we renamed mEos4Fast2. This protein outperforms any other tested mEos variants and challenges the very fast-maturing mEosEM and pcStar.

Maity et al. (2025)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change