compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

pcStar

This protein has unmoderated changes.

pcStar is a photoconvertible red fluorescent protein published in 2019, derived from Lobophyllia hemprichii. It has high acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Lobophyllia hemprichii	25.7 kDa	-

FPbase ID: 3SXVB

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
Green	505	515	74,376	0.89	66.19	5.49
Red	567	579	48,403	0.44	21.3	6.14

Edit States/Attributes

Transitions

From	To	Switch λ
Green	Red	405

Edit state transitions

Photostability

No photostability measurements available ... add one!

pcStar Sequence

BLAST

pcStar was derived from mEos3.2 with the following mutations: D28E/L93M/N166GD28E/L93M/N166G

MSAIKPDMKIKLRMEGNVNGHHFVIDGEGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAKYPDNIQDYFKQSFPKGYSWERSMTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGGAHYRCDFRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for pcStar
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fast Super-Resolution Imaging Technique and Immediate Early Nanostructure Capturing by a Photoconvertible Fluorescent Protein

Zhang M, Fu Z, Li C, Liu A, Peng D, Xue F, He W, Gao S, Xu F, Xu D, Yuan L, Zhang F, Xu Z, Xu T, Xu P

(2019). Nano Letters, 20(4) , 2197-2208. doi: 10.1021/acs.nanolett.9b02855. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for pcStar
Search RIKEN BRC for pcStar

Change history

Something missing or incorrect? Submit a change Submit a change