compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mCitrine

You are viewing an older revision of this protein, from Nov 7, 2019 18:29:35. Click here to view the current version.

mCitrine is a basic (constitutively fluorescent) yellow fluorescent protein published in 2001, derived from Aequorea victoria.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	27.1 kDa	-

FPbase ID: 3Q37R

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
516	529	94,000	0.74	69.56

Edit States/Attributes

mCitrine OSER Measurements

% Normal Cells	OSER/NE ratio	Cell Type	Reference
93.8 ± 2.6 (10000 cells)	-	HeLa	Hoi et al. (2013)
93.8 ± 2.6 (10000 cells)	-	HeLa	Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

mCitrine Sequence

BLAST

mCitrine was derived from Citrine with the following mutations: A207KA206K
amino acid numbers relative to CitrineavGFP. show relative to avGFP show relative to Citrine

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mCitrine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).