compare

Comparison List

mAzamiGreen

a.k.a. mAG

similar: AzamiGreen

mAzamiGreen is a basic (constitutively fluorescent) green fluorescent protein published in 2003, derived from Galaxea fascicularis. It has high acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Galaxea fascicularis 25.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
492 505 41,800 0.81 33.86 6.2    

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
90.3 ± 4.7 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

no photostability measurements available ... add one!

mAzamiGreen Sequence

MSVIKPEMKIKLCMRGTVNGHNFVIEGEGKGNPYEGTQILDLNVTEGAPLPFAYDILTTVFQYGNRAFTKYPADIQDYFKQTFPEGYHWERSMTYEDQGICTATSNISMRGDCFFYDIRFDGTNFPPNGPVMQKKTLKWEPSTEKMYVRDGVLKGDVNMALLLEGGGHYRCDFKTTYKAKKDVRLPDAHKVDHRIEILKHDKDYNKVKLYENAVARYSMLPSQAK
GenBank: BAD52002
UniProtKB: Q60I24
IPG: 3705442

Structure

Deposited: ,
Chromophore (QYG):

Excerpts

No excerpts have been added for mAzamiGreen
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change