compare

Comparison List

AzamiGreen

a.k.a. AG

similar: mAzamiGreen

AzamiGreen is a basic (constitutively fluorescent) green fluorescent protein published in 2003, derived from Galaxea fascicularis. It has low acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Tetramer Galaxea fascicularis 26.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
492 505 72,300 0.67 48.44 5.0    

Photostability

no photostability measurements available ... add one!

AzamiGreen Sequence

MSVIKPEMKIKLCMRGTVNGHNFVIEGEGKGNPYEGTQILDLNVTEGAPLPFAYDILTTVFQYGNRAFTKYPADIQDYFKQTFPEGYHWERSMTYEDQGICTATSNISMRGDCFFYDIRFDGVNFPPNGPVMQKKTLKWEPSTEKMYVRDGVLKGDVNMALLLEGGGHYRCDFKTTYKAKKDVRLPDYHFVDHRIEILKHDKDYNKVKLYENAVARYSMLPSQAK
GenBank: BAD52001
UniProtKB: Q60I25
IPG: 3705446

Excerpts

No excerpts have been added for AzamiGreen
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change