compare

Comparison List

mAmetrine

mAmetrine is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2008, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer with moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
406 526 45,000 0.58 26.1 6.0 1.8  

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
90.0 ± 4.5 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
2.8 Ai et al. (2008)

mAmetrine Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTSGKLPVPWPTLVTTLSYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTISFKDDGSYRTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNMNVWDAYITADKQKNGIKANFKIEHNVEDGGVQLADAYQQNTPIGDGSVLLPDNHYLSFQSKLFKDPNEQRDHMVLLEFVTAAGITPGMDELYK
GenBank: ABW74903
IPG: 13918900

Excerpts

No excerpts have been added for mAmetrine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change