compare

Comparison List

LSSmOrange

LSSmOrange is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2012, derived from Discosoma sp.. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: OVJRJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
437 572 52,000 0.45 23.4 5.7 138.0  

Photostability

No photostability measurements available ... add one!

LSSmOrange Sequence

LSSmOrange was derived from mOrange with the following mutations: A44V/F83L/W143M/I161D/M163L/G196D
amino acid numbers relative to DsRed. show relative to mOrange

MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTVKLKVTKGGPLPFAWDILSPQFTYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGMEASSERMYPEDGALKGEDKLRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for LSSmOrange
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change