compare

Comparison List

LSSmOrange

LSSmOrange is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2012, derived from Discosoma sp.. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: OVJRJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
437 572 52,000 0.45 23.4 5.7 138.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

LSSmOrange Sequence

BLAST

LSSmOrange was derived from mOrange with the following mutations: A44V/F83L/W143M/I161D/M163L/G196D
amino acid numbers relative to DsRed. show relative to mOrange

MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTVKLKVTKGGPLPFAWDILSPQFTYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGMEASSERMYPEDGALKGEDKLRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for LSSmOrange
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An Orange Fluorescent Protein with a Large Stokes Shift for Single-Excitation Multicolor FCCS and FRET Imaging

Shcherbakova Dm, Hink Ma, Joosen L, Gadella Twj, Verkhusha Vv

(2012). Journal of the American Chemical Society, 134(18) , 7913-7923. doi: 10.1021/ja3018972. Article   Pubmed

Additional References

  1. Two-Photon Excitation Spectra of Various Fluorescent Proteins within a Broad Excitation Range

    Leben R, Lindquist Rl, Hauser Ae, Niesner R, Rakhymzhan A

    (2022). International Journal of Molecular Sciences, 23(21) , 13407. doi: 10.3390/ijms232113407. Article

  2. Photoconvertible Behavior of LSSmOrange Applicable for Single Emission Band Optical Highlighting

    De Keersmaecker H, Fron E, Rocha S, Kogure T, Miyawaki A, Hofkens J, Mizuno H

    (2016). Biophysical Journal, 111(5) , 1014-1025. doi: 10.1016/j.bpj.2016.07.033. Article   Pubmed

  3. Mechanism Behind the Apparent Large Stokes Shift in LSSmOrange Investigated by Time-Resolved Spectroscopy

    Fron E, De Keersmaecker H, Rocha S, Baeten Y, Lu G, Uji-I H, Van Der Auweraer M, Hofkens J, Mizuno H

    (2015). The Journal of Physical Chemistry B, 119(47) , 14880-14891. doi: 10.1021/acs.jpcb.5b09189. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change