compare

Comparison List

LSSA12

a.k.a. LSSA12

LSSA12 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2022, derived from Aequorea victoria. It has low acid sensitivity.
+
LSSA12 Spectrum Fluorescent protein LSSA12 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: V81JD

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
398 511 38,700 0.38 14.71 4.6    

Photostability

No photostability measurements available ... add one!

LSSA12 Sequence

LSSA12 was derived from Hyperfolder YFP with the following mutations: G65S/Y203I/Q204E/E222D/R223F
amino acid numbers relative to avGFP. show relative to Hyperfolder YFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKLISTTGKLPVPWPTLVTTLSYGLMVFARYPDHMKQHDFFKSAMPEGYVQERTISFEDDGYYKTRAEVKFEGDTLVNRIVLKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSIESVLSKDPNEKRDHMVLKDFVTAAGITHDMNELYK
GenBank: OP373688

Excerpts

LSSA12 was more stable in guanidinium HCl (GdnHCl) than mT-Sapphire, mAmetrine, and eGFP (Extended Data Fig. 6e). Site-directed mutagenesis confirmed the functional importance of the E222D and G65S mutations in LSSA12 (Extended Data Fig. 6f). LSSmGFP and LSSA12 enjoy similar advantages as hfYFP, including the absence of cysteine residues, low pKa, tolerance of fixatives, high chemical and thermal stability, and a single excitation band.

Campbell et al. (2022)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change