compare

Comparison List

LSSmGFP

a.k.a. LSSmGFP

LSSmGFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2022, derived from Aequorea victoria. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: SGW8V

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
400 510 36,900 0.48 17.71 4.7    

Photostability

No photostability measurements available ... add one!

LSSmGFP Sequence

LSSmGFP was derived from Hyperfolder YFP with the following mutations: T43S/G65S/L68Q/H77N/K140N/Y203I/V206K
amino acid numbers relative to avGFP. show relative to Hyperfolder YFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLSLKLISTTGKLPVPWPTLVTTLSYGQMVFARYPDNMKQHDFFKSAMPEGYVQERTISFEDDGYYKTRAEVKFEGDTLVNRIVLKGIDFKEDGNILGHNLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSIQSKLSKDPNEKRDHMVLKERVTAAGITHDMNELYK
GenBank: OP373689

Excerpts

Benefiting from the hfYFP crystal structure, we eliminated hfYFP’s 514-nm excitability and produced two exclusively 405-nm excitable GFPs with [a large Stokes shift], LSSA12 and LSSmGFP. These LSS FPs overcome the cross-excitation problem of mT-Sapphire (Fig. 5c–e) without sacrificing molecular brightness (Table 1). LSSmGFP has high chemical and thermodynamic stability and the same molecular brightness as mAmetrine, while lasting twice as long under laser-scanning confocal illumination before photobleaching (Extended Data Fig. 7g).

Campbell et al. (2022)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change