compare

Comparison List

EYFP

a.k.a. 10C

EYFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 1996, derived from Aequorea victoria. It has high acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 27.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
513 527 83,400 0.61 50.87 6.9   3.1

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
60.0 SPIESS et al. (2005)

EYFP Sequence

EYFP was derived from avGFP with the following mutations: M1_S2insV/S65G/V68L/S72A/T203Y/H231L

Note: There is inconsistency in the literature regarding the identity of "EYFP", and whether it contains V68L. Some papers (Lybarger et al. 1998; Patterson et al 2001) equate it with mutant 10C, introduced in Ormö et al 1996, which includes V68L. However, Miyawaki 1997 & 1999 and Nagai 2002 omit V68L, yet another paper from the same group (Rekas 2002) includes V68L (as do most definitions of 'Venus' which derives from EYFP). Here we include V68L, and define EYFP as an alias for 10C.

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore (GYG):

Excerpts

No excerpts have been added for EYFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Crystal Structure of the Aequorea victoria Green Fluorescent Protein

Orm  M, Cubitt Ab, Kallio K, Gross La, Tsien Ry, Remington Sj

(1996). Science, 273(5280) , 1392-1395. doi: 10.1126/science.273.5280.1392. Article

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change