compare

Comparison List

mEYFP

similar: EYFP

mEYFP is a basic (constitutively fluorescent) yellow fluorescent protein published in 2002, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: SBLM5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
515 528 79,000 0.62 48.98   9.0  

Photostability

No photostability measurements available ... add one!

mEYFP Sequence

mEYFP was derived from EYFP with the following mutations: A206K
amino acid numbers relative to avGFP. show relative to EYFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mEYFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Partitioning of Lipid-Modified Monomeric GFPs into Membrane Microdomains of Live Cells

Zacharias Da

(2002). Science, 296(5569) , 913-916. doi: 10.1126/science.1068539. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change