compare

Comparison List

EYFP-Q69K

a.k.a. EYFP-V68L/Q69K

EYFP-Q69K is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 1999, derived from Aequorea victoria. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 27.0 kDa -

FPbase ID: XZJ98

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
514 526 72,000 0.76 54.72 5.8    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

EYFP-Q69K Sequence

BLAST

EYFP-Q69K was derived from EYFP with the following mutations: Q69K
amino acid numbers relative to avGFP. show relative to EYFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLKCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for EYFP-Q69K
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Dynamic and quantitative Ca2+ measurements using improved cameleons

Miyawaki A, Griesbeck O, Heim R, Tsien Ry

(1999). Proceedings of the National Academy of Sciences, 96(5) , 2135-2140. doi: 10.1073/pnas.96.5.2135. Article

Additional References

  1. Cyan and Yellow Super Fluorescent Proteins with Improved Brightness, Protein Folding, and FRET Förster Radius†,‡

    Kremers G-J, Goedhart J, Van Munster Eb, Gadella Twj

    (2006). Biochemistry, 45(21) , 6570-6580. doi: 10.1021/bi0516273. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change