compare

Comparison List

W7

W7 is a basic (constitutively fluorescent) cyan fluorescent protein published in 1996, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: ZVV1B

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
433 475 18,000 0.67 12.06      

Photostability

No photostability measurements available ... add one!

W7 Sequence

W7 was derived from CFP with the following mutations: N146I/M153T/V163A/N212K

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPKEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for W7
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-Color Green Fluorescent Protein Time-Lapse Imaging

    Ellenberg J, Lippincott-Schwartz J, Presley Jf

    (1998). BioTechniques, 25(5) , 838-846. doi: 10.2144/98255bt01. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change