compare

Comparison List

Dendra2-M159A

Dendra2-M159A is a multi-photochromic yellow fluorescent protein published in 2011, derived from Dendronephthya sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Dendronephthya sp. 26.1 kDa -

FPbase ID: CQ4QL

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green (off)              
Orange (off)              
Green 471 504 51,100 0.55 28.11 6.5   2.8
Orange 528 562 45,000 0.75 33.75 6.8   4.0
Edit States/Attributes

Transitions

From To Switch λ
Green (off) Green 405
Green Orange 405
Orange (off) Orange 440
Green Green (off) 488
Orange Orange (off) 561
Edit state transitions

Photostability

No photostability measurements available ... add one!

Dendra2-M159A Sequence

BLAST

Dendra2-M159A was derived from Dendra2 with the following mutations: M159A
amino acid numbers relative to dendFP. show relative to Dendra2

MNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINAALLLEGGGHYLCDFKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQVW

Excerpts

No excerpts have been added for Dendra2-M159A
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational Design of Photoconvertible and Biphotochromic Fluorescent Proteins for Advanced Microscopy Applications

Adam V, Moeyaert B, David Cc, Mizuno H, Lelimousin M, Dedecker P, Ando R, Miyawaki A, Michiels J, Engelborghs Y, Hofkens J

(2011). Chemistry & Biology, 18(10) , 1241-1251. doi: 10.1016/j.chembiol.2011.08.007. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change