compare

Comparison List

Dendra2-M159A

Dendra2-M159A is a multi-photochromic yellow fluorescent protein published in 2011, derived from Dendronephthya sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Dendronephthya sp. 26.1 kDa -

FPbase ID: CQ4QL

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 471 504 51,100 0.55 28.11 6.5   2.8
Orange 528 562 45,000 0.75 33.75 6.8   4.0
Green (off)              
Orange (off)              

Transitions

From To Switch λ
Green Orange 405
Green (off) Green 405
Orange (off) Orange 440
Green Green (off) 488
Orange Orange (off) 561

Photostability

No photostability measurements available ... add one!

Dendra2-M159A Sequence

Dendra2-M159A was derived from Dendra2 with the following mutations: M159A
amino acid numbers relative to dendFP. show relative to Dendra2

MNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINAALLLEGGGHYLCDFKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQVW

Excerpts

No excerpts have been added for Dendra2-M159A
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change