compare

Comparison List

dendFP

a.k.a. dendRFP, dendGFP

dendFP is a multistate green fluorescent protein published in 2002, derived from Dendronephthya sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Dendronephthya sp. 25.8 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 557 575 35,000 0.68 23.8 5.2    
Green 492 508 90,000 0.65 58.5 6.5    
Edit state transitions

Photostability

no photostability measurements available ... add one!

dendFP Sequence

MNLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTLNLTVKEGAPLPFSYDILTTALHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTYEDKGICTIRSDISLEGDCFFQNVRFNGMNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDYHFVDHRIEILSNDSDYNKVKLYEHGVARYSPLPSQAW
GenBank: AAM10625
UniProtKB: Q8T6U0
IPG: 4560782

Excerpts

No excerpts have been added for dendFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change