compare

Comparison List

td8ox2StayGold

td8ox2StayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2023, derived from Cytaeis uchidae.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tandem dimer Cytaeis uchidae 54.1 kDa -

FPbase ID: XFHQO

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
496 506 159,000 0.93 147.87      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

td8ox2StayGold Sequence

BLAST

td8ox2StayGold was derived from td8oxStayGold with the following mutations: Y169F/Y174yF
amino acid numbers relative to CU17S. show relative to td8oxStayGold

MVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAFQNTIIKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHIIQSETLEAHLYSRTKLEGHGTGSTGSGSSGTASSEDNNIDMVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAFQNTIIKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHIIQSETLEAHL
GenBank: LC756337

Excerpts

We found that PT can be used as another adaptor for fusion at the StayGold C terminus. By replacing c4 with PT in td5oxStayGold, we generated td8oxStayGold. In addition, we performed saturation mutagenesis on td8oxStayGold for Tyr169 and generated td8ox2StayGold with a Y169F mutation. Both td8oxStayGold and td8ox2StayGold exhibited excellent dispersibility.

Ando et al. (2023)

Primary Reference

StayGold variants for molecular fusion and membrane-targeting applications

Ando R, Shimozono S, Ago H, Takagi M, Sugiyama M, Kurokawa H, Hirano M, Niino Y, Ueno G, Ishidate F, Fujiwara T, Okada Y, Yamamoto M, Miyawaki A

(2023). Nature Methods, , . doi: 10.1038/s41592-023-02085-6. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change