compare

Comparison List

FusionRed-M

a.k.a. FR-M

FusionRed-M is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Entacmaea quadricolor.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 25.6 kDa -

FPbase ID: E3FDV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
571 594 71,100 0.34 24.17     2.1
Edit States/Attributes

FusionRed-M OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
87.0 (500 cells) - U-2 OS Manna et al. (2018)

Photostability

No photostability measurements available ... add one!

FusionRed-M Sequence

BLAST

FusionRed-M was derived from FusionRed with the following mutations: L170M
amino acid numbers relative to eqFP578. show relative to FusionRed

MVSELIKENMPMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFIKHPPGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKVRGVNFPANGPVMQKKTLGWEASTETMYPADGGLEGACDMALKLVGGGHMICNLETTYRSKKPATNLKMPGVYNVDHRLERIKEADDETYVEQHEVAVARYSTGGAGDGGK

Excerpts

No excerpts have been added for FusionRed-M
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Directed evolution of excited state lifetime and brightness in FusionRed using a microfluidic sorter

Manna P, Hung S-T, Mukherjee S, Friis P, Simpson Dm, Lo Mn, Palmer Ae, Jimenez R

(2018). Integrative Biology, 10(9) , 516-526. doi: 10.1039/c8ib00103k. Article   Pubmed

Additional References

  1. Erratum: Directed evolution of excited state lifetime and brightness in FusionRed using a microfluidic sorter

    Manna P, Hung S-T, Mukherjee S, Friis P, Simpson Dm, Lo M, Palmer Ae, Jimenez R

    (2019). Integrative Biology, , . doi: 10.1093/intbio/zyz032. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change