compare

Comparison List

Cerulean

similar: mCerulean

Cerulean is a basic (constitutively fluorescent) cyan fluorescent protein published in 2004, derived from Aequorea victoria. It has low acid sensitivity.
+
Cerulean Spectrum Fluorescent protein Cerulean excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: CVUYM

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
433 475 43,000 0.62 26.66 4.7   3.3
Edit States/Attributes

Cerulean OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
78.3 ± 4.8 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
36.0   Lelimousin et al. (2009)
A caution on interpretation of photostability measurements
Add photostability info

Cerulean Sequence

BLAST

Cerulean was derived from ECFP with the following mutations: S72A/Y145A/H148D
amino acid numbers relative to avGFP. show relative to ECFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Cerulean
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An improved cyan fluorescent protein variant useful for FRET

Rizzo Ma, Springer Gh, Granada B, Piston Dw

(2004). Nature Biotechnology, 22(4) , 445-449. doi: 10.1038/nbt945. Article   Pubmed

Additional References

  1. Intrinsic Dynamics in ECFP and Cerulean Control Fluorescence Quantum Yield

    Lelimousin M, Noirclerc-Savoye M, Lazareno-Saez C, Paetzold B, Le Vot S, Chazal R, Macheboeuf P, Field Mj, Bourgeois D, Royant A

    (2009). Biochemistry, 48(42) , 10038-10046. doi: 10.1021/bi901093w. Article   Pubmed

  2. X-ray Structure of Cerulean GFP:  A Tryptophan-Based Chromophore Useful for Fluorescence Lifetime Imaging†,‡

    Malo Gd, Pouwels Lj, Wang M, Weichsel A, Montfort Wr, Rizzo Ma, Piston Dw, Wachter Rm

    (2007). Biochemistry, 46(35) , 9865-9873. doi: 10.1021/bi602664c. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change