compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mCerulean

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Oct 28, 2018 01:38:03. Or view the full change history

mCerulean is a basic (constitutively fluorescent) cyan fluorescent protein published in 2005, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	26.8 kDa	-

FPbase ID: J2JWA

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
433	475	33,000	0.49	16.17		6.6

Edit States/Attributes

mCerulean OSER Measurements

% Normal Cells	OSER/NE ratio	Cell Type	Reference
92.6 ± 2.0 (10000 cells)	-	HeLa	Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

mCerulean Sequence

BLAST

mCerulean was derived from Cerulean with the following mutations: A207KA206K
amino acid numbers relative to CeruleanavGFP. show relative to avGFP show relative to Cerulean

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mCerulean
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).