compare

Comparison List

mEos4Fast2

a.k.a. mEos4b-T59Q-L93M

mEos4Fast2 is a photoconvertible red fluorescent protein published in 2025, derived from Lobophyllia hemprichii. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.9 kDa -

FPbase ID: 9KH59

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 499 513 78,020 0.82 63.98 4.9 27.0  
Red 565 580 43,290 0.54 23.38 5.4    

Transitions

From To Switch λ
Green Red 405

Photostability

No photostability measurements available ... add one!

mEos4Fast2 Sequence

mEos4Fast2 was derived from mEos4b-L93M with the following mutations: T59Q
amino acid numbers relative to EosFP. show relative to mEos4b-L93M

MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQTMDLEVKEGGPLPFAFDILTQAFHYGNRVFVKYPDNIQDYFKQSFPKGYSWERSMTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHAIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

In contrast, the T59Q mutation significantly improved the apparent maturation time, particularly in the variant mEos4b-T59Q-L93M, which we renamed mEos4Fast2. This protein outperforms any other tested mEos variants and challenges the very fast-maturing mEosEM and pcStar.

Maity et al. (2025)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change