compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

msGFP2

similar: SGFP2

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Mar 31, 2023 17:48:19. Or view the full change history

msGFP2 is a basic (constitutively fluorescent) green fluorescent protein published in 2019, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	26.2 kDa	-

FPbase ID: 4VSRL

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
489	509	52,200	0.59	30.8

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

msGFP2 Sequence

BLAST

MDSTESLFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTITFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITGGSGGS

Excerpts

We previously generated msGFP, a monomeric superfolder derivative of EGFP. Unfortunately, compared to EGFP, msGFP and other superfolder GFP variants show faster photobleaching. We now describe msGFP2, which retains monomeric superfolder properties while being as photostable as EGFP. msGFP2 contains modified N- and C-terminal peptides that are expected to reduce nonspecific interactions. Compared to EGFP and mEGFP, msGFP2 is less prone to disturbing the functions of certain partner proteins.

Valbuena et al. (2019)

Primary Reference

A photostable monomeric superfolder GFP

Valbuena F, Fizgerald I, Strack Rl, Andruska N, Smith L, Glick Bs

(2019). , , . doi: 10.1101/811588. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for msGFP2
Search RIKEN BRC for msGFP2

Change history

Something missing or incorrect? Submit a change Submit a change