compare

Comparison List

SGFP2

similar: msGFP2

SGFP2 is a basic (constitutively fluorescent) green fluorescent protein published in 2007, derived from Aequorea victoria. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: TR5BB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
495 512 46,000 0.7 32.2 5.9    
Edit States/Attributes

SGFP2 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
77.0 (104 cells) 1.7 ± 0.2 (40 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
1.9   Kremers et al. (2007)
A caution on interpretation of photostability measurements
Add photostability info

SGFP2 Sequence

BLAST

SGFP2 was derived from SGFP1 with the following mutations: L68V
amino acid numbers relative to avGFP. show relative to SGFP1

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: ABM97852
IPG: 6755366

Excerpts

No excerpts have been added for SGFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improved Green and Blue Fluorescent Proteins for Expression in Bacteria and Mammalian Cells†,‡

Kremers G-J, Goedhart J, Van Den Heuvel Dj, Gerritsen Hc, Gadella Twj

(2007). Biochemistry, 46(12) , 3775-3783. doi: 10.1021/bi0622874. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change