compare

Comparison List

TurboFP602

TurboFP602 is a basic (constitutively fluorescent) red fluorescent protein, derived from Entacmaea quadricolor. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.3 kDa -

FPbase ID: 4QJ63

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
574 602 74,400 0.35 26.04 4.7    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

TurboFP602 Sequence

BLAST

TurboFP602 was derived from TurboRFP with the following mutations: M1_S2insVGED/K6T/F110L/I115L/R138L/N143S/G152S/S158G/F174L/R231S

MVGEDSELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMKIKVVEGGPLPFAFDILATSFMYGSKAFINHTQGIPDFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGCLIYNVKINGVNFPSNGPVMQKKTLGWEASTEMLYPADSGLRGHGQMALKLVGGGYLHCSLKTTYRSKKPAKNLKMPGFHFVDHRLERIKEADKETYVEQHEMAVAKYCDLPSKLGHS

Excerpts

No excerpts have been added for TurboFP602
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Bright monomeric red fluorescent protein with an extended fluorescence lifetime

    Merzlyak Em, Goedhart J, Shcherbo D, Bulina Me, Shcheglov As, Fradkov Af, Gaintzeva A, Lukyanov Ka, Lukyanov S, Gadella Twj, Chudakov Dm

    (2007). Nature Methods, 4(7) , 555-557. doi: 10.1038/nmeth1062. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change