compare

Comparison List

avGFP

a.k.a. wtGFP, GFP, gfp10, Green Fluorescent Protein

avGFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 1992, derived from Aequorea victoria. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: 1XF1B

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
395 509 25,000 0.79 19.75 4.5    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

avGFP Sequence

BLAST
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: AAA27721
UniProtKB: P42212
IPG: 1266562

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for avGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Primary structure of the Aequorea victoria green-fluorescent protein

Prasher Dc, Eckenrode Vk, Ward Ww, Prendergast Fg, Cormier Mj

(1992). Gene, 111(2) , 229-233. doi: 10.1016/0378-1119(92)90691-h. Article

Additional References

  1. Spectroscopic and Structural Study of Proton and Halide Ion Cooperative Binding to GFP

    Arosio D, Garau G, Ricci F, Marchetti L, Bizzarri R, Nifosì R, Beltram F

    (2007). Biophysical Journal, 93(1) , 232-244. doi: 10.1529/biophysj.106.102319. Article   Pubmed

  2. Aequoreagreen fluorescent protein

    Inouye S, Tsuji Fi

    (2001). FEBS Letters, 341(2-3) , 277-280. doi: 10.1016/0014-5793(94)80472-9. Article

  3. THE GREEN FLUORESCENT PROTEIN

    Tsien Ry

    (1998). Annual Review of Biochemistry, 67(1) , 509-544. doi: 10.1146/annurev.biochem.67.1.509. Article   Pubmed

  4. Use of the green fluorescent protein and its mutants in quantitative fluorescence microscopy

    Patterson Gh, Knobel Sm, Sharif Wd, Kain Sr, Piston Dw

    (1997). Biophysical Journal, 73(5) , 2782-2790. doi: 10.1016/s0006-3495(97)78307-3. Article

  5. Deletions of theAequorea victoriaGreen Fluorescent Protein Define the Minimal Domain Required for Fluorescence

    Li X, Zhang G, Ngo N, Zhao X, Kain Sr, Huang C-C

    (1997). Journal of Biological Chemistry, 272(45) , 28545-28549. doi: 10.1074/jbc.272.45.28545. Article

  6. Crystal Structure of the Aequorea victoria Green Fluorescent Protein

    Orm  M, Cubitt Ab, Kallio K, Gross La, Tsien Ry, Remington Sj

    (1996). Science, 273(5280) , 1392-1395. doi: 10.1126/science.273.5280.1392. Article

  7. The molecular structure of green fluorescent protein

    Yang F, Moss Lg, Phillips Gn

    (1996). Nature Biotechnology, 14(10) , 1246-1251. doi: 10.1038/nbt1096-1246. Article   Pubmed

  8. Improved green fluorescence

    Heim R, Cubitt Ab, Tsien Ry

    (1995). Nature, 373(6516) , 663-664. doi: 10.1038/373663b0. Article   Pubmed

  9. Green fluorescent protein as a marker for gene expression

    Chalfie M, Tu Y, Euskirchen G, Ward W, Prasher D

    (1994). Science, 263(5148) , 802-805. doi: 10.1126/science.8303295. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change