compare

Comparison List

avGFP

a.k.a. wtGFP, GFP, gfp10, Green Fluorescent Protein

avGFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 1992, derived from Aequorea victoria. It has low acid sensitivity.
+
avGFP Spectrum Fluorescent protein avGFP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: 1XF1B

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
395 509 25,000 0.79 19.75 4.5    

Photostability

No photostability measurements available ... add one!

avGFP Sequence

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: AAA27721
UniProtKB: P42212
IPG: 1266562

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for avGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Aequoreagreen fluorescent protein

    Inouye S, Tsuji Fi

    (2001). FEBS Letters, 341(2-3) , 277-280. doi: 10.1016/0014-5793(94)80472-9. Article

  2. THE GREEN FLUORESCENT PROTEIN

    Tsien Ry

    (1998). Annual Review of Biochemistry, 67(1) , 509-544. doi: 10.1146/annurev.biochem.67.1.509. Article   Pubmed

  3. Deletions of theAequorea victoriaGreen Fluorescent Protein Define the Minimal Domain Required for Fluorescence

    Li X, Zhang G, Ngo N, Zhao X, Kain Sr, Huang C-C

    (1997). Journal of Biological Chemistry, 272(45) , 28545-28549. doi: 10.1074/jbc.272.45.28545. Article

  4. The molecular structure of green fluorescent protein

    Yang F, Moss Lg, Phillips Gn

    (1996). Nature Biotechnology, 14(10) , 1246-1251. doi: 10.1038/nbt1096-1246. Article   Pubmed

  5. Crystal Structure of the Aequorea victoria Green Fluorescent Protein

    Orm  M, Cubitt Ab, Kallio K, Gross La, Tsien Ry, Remington Sj

    (1996). Science, 273(5280) , 1392-1395. doi: 10.1126/science.273.5280.1392. Article

  6. Improved green fluorescence

    Heim R, Cubitt Ab, Tsien Ry

    (1995). Nature, 373(6516) , 663-664. doi: 10.1038/373663b0. Article   Pubmed

  7. Green fluorescent protein as a marker for gene expression

    Chalfie M, Tu Y, Euskirchen G, Ward W, Prasher D

    (1994). Science, 263(5148) , 802-805. doi: 10.1126/science.8303295. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change