compare

Comparison List

Comparing:

EGFP, mKate2

You can share this comparison at: www.fpbase.org/compare/egfp,mkate2

Attribute Comparison

Name λex λem StokesλΔ EC QY Brightness pKa Aggregation Maturation Lifetimeτ kDa
EGFP 488 507 19 55,900 0.6 33.54 6.0 wd 25.0 2.6 26.94
mKate2 588 633 45 62,500 0.4 25.0 5.4 m 20.0 2.5 26.07

Sequence Comparison

EGFP              MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY-GKLTLKFIC
                  |||***||************|*||*|*|****||||***|*|**|*****
mKate2            MVS---ELIKENMHMKLYMEGTVNNHHFKCTSEGEG-KPYEGTQTMRIKA
                  
EGFP              TT-GKLPVPWPTLVTTLTYGVQCFSRYPDHMKQ--HDFFKSAMPEGYVQE
                  ***|*||*****|*|***||***|*****|**|***||||***|||***|
mKate2            VEGGPLPFAFDILATSFMYGSKTFI---NH-TQGIPDFFKQSFPEGFTWE
                  
EGFP              R-TIFFKDDGNYKTRA-EVKFEGDTLVNRIELKGIDFKEDGNILGHK-LE
                  |*|*****||***|***********|*******|**|***|*****|*|*
mKate2            RVTTY--EDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLG
                  
EGFP              YNYNSHNVYIMADKQKNGI--KVNFKIRHNIEDGSV--QLADHYQQNTPI
                  ********|**||****|***************|*****|***|****|*
mKate2            WEASTETLY-PAD---GGLEGRADMALK-LVGGGHLICNLKTTYRSKKPA
                  
EGFP              GDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDEL-Y
                  *******|***|********|****|*******|***|****|****|**
mKate2            KN--LKMPGVYYVDRRLERIKEA-DKETYVEQHEVAVARYCDL-PSKLGH
                  
EGFP              K
                  *
mKate2            R

Mutations: K4_E6del/F9I/T10K/G11E/V12N/V13M/P14H/I15M/L16K/V17L/E18Y/L19M/D20E/D22T/G25N/K27H/S29K/V30C/S31T/G32S/D37_T39delinsKP/Y40_G41insE/K42T/L43Q/L45M/K46R/F47I/I48K/C49A/T50V/T51E/T51_G52insG/K53P/V56F/P57A/W58F/P59D/T60I/V62A/T64S/L65F/T66M/V69S/Q70K/C71T/S73I/R74_D77delinsN/M79_K80delinsT/Q81_H82insGI/H82P/S87Q/A88S/M89F/Y93F/V94T/Q95W/R97_T98insV/I99T/F100Y/F101_D103delinsE/N106G/Y107V/K108L/R110A/A111T/A111_E112insQ/E112D/V113T/K114S/F115L/E116Q/G117D/D118G/T119C/V121I/N122Y/R123N/I124V/E125K/L126I/K127R/I129V/D130N/K132P/E133S/D134N/N136P/I137V/L138M/G139Q/H140K/K141_L142insT/E143G/Y144W/N145E/Y146A/N147S/S148T/H149E/N150T/V151L/I153_M154delinsP/K157_N160delinsG/I162_K163insEG/I162L/K163R/V164A/N165D/F166M/K167A/I168L/R169K/H170_D174delinsLVGG/S176H/V177_Q178insIC/V177L/Q178N/A180K/D181T/H182T/Q184R/Q185S/N186K/T187K/I189A/G190K/D191N/G192_L196delinsLKM/D198G/N199V/H200Y/L202V/S203D/T204R/Q205R/S206L/A207E/L208R/S209I/D211E/P212A/N213_E214delinsD/R216E/D217T/H218Y/M219V/V220E/L221Q/L222H/F224V/V225A/T226V/A228R/G229Y/I230C/T231D/G233_E236delinsPSK/L237_Y238insG/Y238H/K239R

Note: exact amino acid positions in mutations is still experimental and may be inaccurate/relative

References

  1. Cormack et al. (1996) FACS-optimized mutants of the green fluorescent protein (GFP). Gene.Journal

  2. Yang et al. (1996) Optimized Codon Usage and Chromophore Mutations Provide Enhanced Sensitivity with the Green Fluorescent Protein. Nucleic Acids Research.Journal

  3. Zhang et al. (1996) An Enhanced Green Fluorescent Protein Allows Sensitive Detection of Gene Transfer in Mammalian Cells. Biochemical and Biophysical Research Communications.Journal   Pubmed

  4. Patterson et al. (1997) Use of the green fluorescent protein and its mutants in quantitative fluorescence microscopy. Biophysical Journal.Journal

  5. Cubitt et al. (1998) Chapter 2: Understanding Structure—Function Relationships in the Aequorea victoria Green Fluorescent Protein. Methods in Cell Biology.Journal

  6. Tsien (1998) THE GREEN FLUORESCENT PROTEIN. Annual Review of Biochemistry.Journal   Pubmed

  7. Heikal et al. (2001) Multiphoton molecular spectroscopy and excited-state dynamics of enhanced green fluorescent protein (EGFP): acid–base specificity. Chemical Physics.Journal

  8. Shcherbo et al. (2009) Far-red fluorescent tags for protein imaging in living tissues. Biochemical Journal.Journal   Pubmed

  9. Drobizhev et al. (2011) Two-photon absorption properties of fluorescent proteins. Nature Methods.Journal   Pubmed

  10. Arpino et al. (2012) Crystal Structure of Enhanced Green Fluorescent Protein to 1.35 Å Resolution Reveals Alternative Conformations for Glu222. PLoS ONE.Journal   Pubmed

  11. Sarkisyan et al. (2015) Green Fluorescent Protein with Anionic Tryptophan-Based Chromophore and Long Fluorescence Lifetime. Biophysical Journal.Journal   Pubmed

  12. Bindels et al. (2016) mScarlet: a bright monomeric red fluorescent protein for cellular imaging. Nature Methods.Journal   Pubmed

  13. Heppert et al. (2016) Comparative assessment of fluorescent proteins for in vivo imaging in an animal model system. Molecular Biology of the Cell.Journal   Pubmed

  14. Myšková et al. (2020) Directionality of light absorption and emission in representative fluorescent proteins. Proceedings of the National Academy of Sciences.Journal   Pubmed