compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

YFP3

You are viewing an older revision of this protein, from May 10, 2019 20:17:02. Click here to view the current version.

YFP3 is a fluorescent protein published in 2005, derived from Aequorea victoria.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	27.0 kDa	-

FPbase ID: UPG56

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

YFP3 Sequence

BLAST

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLLCTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALFKDPNEKRDHMVLLEFLTAAGITEGMNELYK

Excerpts

YFP3 possessed six mutations that resulted in an RRC almost fivefold greater than that of the parental pair. YFP3 also conferred a roughly threefold improvement in FRET relative to the fast-maturing Venus YFP.

Nguyen & Daugherty (2005)

Primary Reference

Evolutionary optimization of fluorescent proteins for intracellular FRET

Nguyen Aw, Daugherty Ps

(2005). Nature Biotechnology, 23(3) , 355-360. doi: 10.1038/nbt1066. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for YFP3
Search RIKEN BRC for YFP3

Change history

Something missing or incorrect? Submit a change Submit a change