compare

Comparison List

TagRFP675

TagRFP675 is a basic (constitutively fluorescent) red fluorescent protein published in 2013, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
TagRFP675 Spectrum Fluorescent protein TagRFP675 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: NLF4R

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
598 675 46,000 0.08 3.68 5.7 25.0 0.9

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
35.0   Piatkevich et al. (2013)

TagRFP675 Sequence

TagRFP675 was derived from mKate with the following mutations: M41Q/F80W/S143N/L147M/S158N/D159Y/N173S/*230LextN
amino acid numbers relative to eqFP578. show relative to mKate

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTQRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFWKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMMYPADGGLEGRNYMALKLVGGGHLICSLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLN

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for TagRFP675
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change