compare

Comparison List

Superfolder YFP

a.k.a. sfYFP

Superfolder YFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2005, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: EFRBB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
513 527          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Superfolder YFP Sequence

BLAST

Superfolder YFP was derived from Superfolder GFP with the following mutations: T203Y

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

We tested whether the superfolder mutations would improve the folding of color variants of folding reporter GFP. Blue, cyan and yellow fluorescent proteins (BFP, CFP, YFP) were produced from folding reporter GFP and superfolder GFP by incorporating the additional mutations Y66H (BFP), Y66W (CFP) and T203Y (YFP), respectively. E. coli colonies expressing the color variants of superfolder GFP as C-terminal fusions with poorly folded ferritin were brightly fluorescent…

Pédelacq et al. (2005)

Primary Reference

Engineering and characterization of a superfolder green fluorescent protein

Pédelacq J-D, Cabantous S, Tran T, Terwilliger Tc, Waldo Gs

(2005). Nature Biotechnology, 24(1) , 79-88. doi: 10.1038/nbt1172. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change