compare

Comparison List

P4

a.k.a. Y66H

P4 is a basic (constitutively fluorescent) blue fluorescent protein published in 1994, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

FPbase ID: 671NA

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
382 448 2,100 0.24 0.5      

Photostability

No photostability measurements available ... add one!

P4 Sequence

P4 was derived from avGFP with the following mutations: Y66H

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for P4
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Wavelength mutations and posttranslational autoxidation of green fluorescent protein.

Heim R, Prasher Dc, Tsien Ry

(1994). Proceedings of the National Academy of Sciences, 91(26) , 12501-12504. doi: 10.1073/pnas.91.26.12501. Article

Additional References

  1. THE GREEN FLUORESCENT PROTEIN

    Tsien Ry

    (1998). Annual Review of Biochemistry, 67(1) , 509-544. doi: 10.1146/annurev.biochem.67.1.509. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change