compare

Comparison List

CFP

a.k.a. Y66W

CFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 1994, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: ZRLU4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
456 480          

Photostability

No photostability measurements available ... add one!

CFP Sequence

CFP was derived from avGFP with the following mutations: Y66W

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for CFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Wavelength mutations and posttranslational autoxidation of green fluorescent protein.

Heim R, Prasher Dc, Tsien Ry

(1994). Proceedings of the National Academy of Sciences, 91(26) , 12501-12504. doi: 10.1073/pnas.91.26.12501. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change