compare

Comparison List

Superfolder GFP

a.k.a. sfGFP

Superfolder GFP is a basic (constitutively fluorescent) green fluorescent protein published in 2005, derived from Aequorea victoria.
+
Superfolder GFP Spectrum Fluorescent protein Superfolder GFP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: B4SOW

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
485 510 83,300 0.65 54.15      

Superfolder GFP OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
- 2.2 ± 0.1 (74 cells) U-2 OS Costantini et al. (2012)
62.4 ± 6.3 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

Superfolder GFP Sequence

Superfolder GFP was derived from Folding Reporter GFP with the following mutations: S30R/Y39N/N105T/Y145F/I171V/A206V

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: ASL68970
IPG: 154375264

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Superfolder GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change