compare

Comparison List

Folding Reporter GFP

Folding Reporter GFP is a basic (constitutively fluorescent) green fluorescent protein published in 1999, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.8 kDa -

FPbase ID: N6ZHS

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
490 530 82,400 0.72 59.33      

Photostability

No photostability measurements available ... add one!

Folding Reporter GFP Sequence

Folding Reporter GFP was derived from αGFP with the following mutations: F64L/S65T

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Folding Reporter GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rapid protein-folding assay using green fluorescent protein

Waldo Gs, Standish Bm, Berendzen J, Terwilliger Tc

(1999). Nature Biotechnology, 17(7) , 691-695. doi: 10.1038/10904. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change