compare

Comparison List

Superfolder CFP

a.k.a. sfCFP

Superfolder CFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2005, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: 41E1T

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
430 479          

Photostability

No photostability measurements available ... add one!

Superfolder CFP Sequence

Superfolder CFP was derived from Superfolder GFP with the following mutations: Y66W

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

We tested whether the superfolder mutations would improve the folding of color variants of folding reporter GFP. Blue, cyan and yellow fluorescent proteins (BFP, CFP, YFP) were produced from folding reporter GFP and superfolder GFP by incorporating the additional mutations Y66H (BFP), Y66W (CFP) and T203Y (YFP), respectively. E. coli colonies expressing the color variants of superfolder GFP as C-terminal fusions with poorly folded ferritin were brightly fluorescent…

Pédelacq et al. (2005)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change