compare

Comparison List

Superfolder BFP

a.k.a. sfBFP

Superfolder BFP is a basic (constitutively fluorescent) fluorescent protein published in 2005, derived from Aequorea victoria. It is reported to be a weak dimer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: BOF2S

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Superfolder BFP Sequence

Superfolder BFP was derived from Superfolder GFP with the following mutations: Y66H

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTHGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

We tested whether the superfolder mutations would improve the folding of color variants of folding reporter GFP. Blue, cyan and yellow fluorescent proteins (BFP, CFP, YFP) were produced from folding reporter GFP and superfolder GFP by incorporating the additional mutations Y66H (BFP), Y66W (CFP) and T203Y (YFP), respectively. E. coli colonies expressing the color variants of superfolder GFP as C-terminal fusions with poorly folded ferritin were brightly fluorescent…

Pédelacq et al. (2005)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change