compare

Comparison List

Skylan-S

a.k.a. Sky lantern for SOFI

Skylan-S is a photoswitchable green fluorescent protein published in 2015.
+
Aggregation Organism Molecular Weight Cofactor
Monomer <add one> 25.7 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 499 511 152,408 0.64 97.54     3.94
Off              

Transitions

From To Switch λ
Off On 405
On Off 488

Photostability

no photostability measurements available ... add one!

Skylan-S Sequence

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFSYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDVEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for Skylan-S
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change