compare

Comparison List

Skylan-S

a.k.a. Sky lantern for SOFI

Skylan-S is a photoswitchable green fluorescent protein published in 2015, derived from Lobophyllia hemprichii.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.7 kDa -

FPbase ID: 11G2Y

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 499 511 152,408 0.64 97.54     3.94
Off              
Edit States/Attributes

Transitions

From To Switch λ
Off On 405
On Off 488
Edit state transitions

Photostability

No photostability measurements available ... add one!

Skylan-S Sequence

BLAST

Skylan-S was derived from mEos3.1 with the following mutations: H62S

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFSYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDVEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for Skylan-S
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Development of a Reversibly Switchable Fluorescent Protein for Super-Resolution Optical Fluctuation Imaging (SOFI)

Zhang X, Chen X, Zeng Z, Zhang M, Sun Y, Xi P, Peng J, Xu P

(2015). ACS Nano, 9(3) , 2659-2667. doi: 10.1021/nn5064387. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change