compare

Comparison List

mEos3.1

mEos3.1 is a photoconvertible green/yellow fluorescent protein published in 2012, derived from Lobophyllia hemprichii. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.7 kDa -

FPbase ID: 73GT1

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 505 513 88,400 0.83 73.37 5.2    
Red 570 580 33,500 0.62 20.77 6.0    
Edit States/Attributes

Transitions

From To Switch λ
Green Red 405
Edit state transitions

Photostability

State t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
Green 6.0 24.0 (µW) Laser Point Scanning Confocal H2B Zhang et al. (2012)
Red 36.7 64.0 (µW) Laser Point Scanning Confocal H2B Zhang et al. (2012)
A caution on interpretation of photostability measurements
Add photostability info

mEos3.1 Sequence

BLAST

mEos3.1 was derived from mEos2-NA with the following mutations: I157V/H158E

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDVEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mEos3.1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational design of true monomeric and bright photoactivatable fluorescent proteins

Zhang M, Chang H, Zhang Y, Yu J, Wu L, Ji W, Chen J, Liu B, Lu J, Liu Y, Zhang J, Xu P, Xu T

(2012). Nature Methods, 9(7) , 727-729. doi: 10.1038/nmeth.2021. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change