compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

SHardonnay

You are viewing an older revision of this protein, from Dec 11, 2018 03:38:44. Click here to view the current version.

SHardonnay is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2013, derived from Aequorea victoria.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	27.0 kDa	-

FPbase ID: 6VP2A

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
511	524	89,000	0.75	66.75			3.4

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

SHardonnay Sequence

BLAST

SHardonnay was derived from EYFP with the following mutations: Y204FY203F
amino acid numbers relative to EYFPavGFP. show relative to avGFP show relative to EYFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSFQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

PDB ID

Deposited: ,
Chromophore:

Excerpts

Our hypothesis also inspired the generation of an eYFP mutant, eliminating the centrosymmetry in the eYFP chromophore by replacing Tyr203 with Phe203 through site-directed mutagenesis. The mutant was named SHardonnay for its improved second-harmonic properties and for its color appearance similar to white wine of the Chardonnay grape.

De Meulenaere et al. (2013)

Primary Reference

Improving the Second-Order Nonlinear Optical Response of Fluorescent Proteins: The Symmetry Argument

De Meulenaere E, Nguyen Bich N, De Wergifosse M, Van Hecke K, Van Meervelt L, Vanderleyden J, Champagne B, Clays K

(2013). Journal of the American Chemical Society, 135(10) , 4061-4069. doi: 10.1021/ja400098b. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for SHardonnay
Search RIKEN BRC for SHardonnay

Change history

Something missing or incorrect? Submit a change Submit a change