compare

Comparison List

SHardonnay

SHardonnay is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2013, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: 6VP2A

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
511 524 89,000 0.75 66.75     3.4

Photostability

No photostability measurements available ... add one!

SHardonnay Sequence

SHardonnay was derived from EYFP with the following mutations: Y203F
amino acid numbers relative to avGFP. show relative to EYFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSFQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

Our hypothesis also inspired the generation of an eYFP mutant, eliminating the centrosymmetry in the eYFP chromophore by replacing Tyr203 with Phe203 through site-directed mutagenesis. The mutant was named SHardonnay for its improved second-harmonic properties and for its color appearance similar to white wine of the Chardonnay grape.

De Meulenaere et al. (2013)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change