compare

Comparison List

SGFP1

SGFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2007, derived from Aequorea victoria. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: TZ5KN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
495 512 42,000 0.62 26.04 6.0    
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
1.7   Kremers et al. (2007)
A caution on interpretation of photostability measurements
Add photostability info

SGFP1 Sequence

BLAST

SGFP1 was derived from mVenus with the following mutations: L46F/G65T/Y203T
amino acid numbers relative to avGFP. show relative to mVenus

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: ABM97851
IPG: 6755340

Excerpts

No excerpts have been added for SGFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improved Green and Blue Fluorescent Proteins for Expression in Bacteria and Mammalian Cells†,‡

Kremers G-J, Goedhart J, Van Den Heuvel Dj, Gerritsen Hc, Gadella Twj

(2007). Biochemistry, 46(12) , 3775-3783. doi: 10.1021/bi0622874. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change