compare

Comparison List

PS-CFP

PS-CFP is a photoconvertible green fluorescent protein published in 2004, derived from Aequorea coerulescens. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea coerulescens 27.3 kDa -

FPbase ID: 6O8HW

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Cyan 402 468 34,000 0.16 5.44 4.0    
Green 490 511 27,000 0.19 5.13 6.0    

Transitions

From To Switch λ
Cyan Green 405

Photostability

No photostability measurements available ... add one!

PS-CFP Sequence

PS-CFP was derived from aceGFP with the following mutations: T62A/N121S/H148T/K158R/I167V/E172K/F221L/G222E/*237WextKLN

Note: The text of Chudakov et al (2004) describes PS-CFP with the mutation K238Q, but the GenBank Sequence does not. Here, we show the GenBank sequence lacking K238Q

MSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVATLSYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVSRIELTGTDFKEDGNILGNKMEYNYNATNVYIMTDKARNGIKVNFKVRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYLEFVTAAAITHGMDELYKWKLN
GenBank: AAT01543

Excerpts

No excerpts have been added for PS-CFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Photoswitchable cyan fluorescent protein as a FRET donor

    Souslova Ea, Chudakov Dm

    (2006). Microscopy Research and Technique, 69(3) , 207-209. doi: 10.1002/jemt.20278. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change