compare

Comparison List

aceGFP

aceGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2010, derived from Aequorea coerulescens.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Aequorea coerulescens 26.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
480 505 50,000 0.55 27.5      

Photostability

no photostability measurements available ... add one!

aceGFP Sequence

MSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYK
GenBank: AAN41637
UniProtKB: Q6YGZ0
IPG: 1780484

Structure

Deposited: ,
Chromophore (SYG):

Excerpts

No excerpts have been added for aceGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change