compare

Comparison List

PAmCherry1

a.k.a. PA-mCherry, PAmCherry

PAmCherry1 is a photoactivatable red fluorescent protein published in 2009, derived from Discosoma sp.. It is reported to be a rapidly-maturing monomer with high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

FPbase ID: OMODZ

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 564 595 18,000 0.46 8.28 6.3 23.0  
Off     6,500          
Edit States/Attributes

Transitions

From To Switch λ
Off On 405
Edit state transitions

Photostability

No photostability measurements available ... add one!

PAmCherry1 Sequence

BLAST

PAmCherry1 was derived from mCherry with the following mutations: E26V/A57T/K70N/L83F/N98K/S146L/I161V/Q163P/L165V/I197R
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHVFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFTWDILSPQFMYGSNAYVKHPADIPDYFKLSFPEGFKWERVMKFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEALSERMYPEDGALKGEVKPRVKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNRKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for PAmCherry1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Photoactivatable mCherry for high-resolution two-color fluorescence microscopy

Subach Fv, Patterson Gh, Manley S, Gillette Jm, Lippincott-Schwartz J, Verkhusha Vv

(2009). Nature Methods, 6(2) , 153-159. doi: 10.1038/nmeth.1298. Article   Pubmed

Additional References

  1. Single-molecule evaluation of fluorescent protein photoactivation efficiency using an in vivo nanotemplate

    Durisic N, Laparra-Cuervo L, Sandoval-Álvarez , Borbely Js, Lakadamyali M

    (2014). Nature Methods, 11(2) , 156-162. doi: 10.1038/nmeth.2784. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change