compare

Comparison List

oxVenus

similar: moxVenus

oxVenus is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2015, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.8 kDa -

FPbase ID: 4GMRC

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
514 526 89,000 0.49 43.61      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

oxVenus Sequence

BLAST

oxVenus was derived from Venus with the following mutations: S30R/Y39N/C48S/C70S/N105T/Y145F/I171V/A206V/L221K
amino acid numbers relative to avGFP. show relative to Venus

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKLISTTGKLPVPWPTLVTTLGYGLQSFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSVLSKDPNEKRDHMVLKEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for oxVenus
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A palette of fluorescent proteins optimized for diverse cellular environments

Costantini Lm, Baloban M, Markwardt Ml, Rizzo M, Guo F, Verkhusha Vv, Snapp El

(2015). Nature Communications, 6(1) , 7670. doi: 10.1038/ncomms8670. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change