compare

Comparison List

moxVenus

similar: oxVenus

moxVenus is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2015, derived from Aequorea victoria. It is reported to be a rapidly-maturing monomer.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: 2KWB9

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
514 526 89,000 0.49 43.61   25.8  

Photostability

No photostability measurements available ... add one!

moxVenus Sequence

moxVenus was derived from oxVenus with the following mutations: V206K
amino acid numbers relative to avGFP. show relative to oxVenus

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKLISTTGKLPVPWPTLVTTLGYGLQSFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLKEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for moxVenus
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change