compare

Comparison List

oxBFP

similar: moxBFP

oxBFP is a basic (constitutively fluorescent) blue fluorescent protein published in 2015, derived from Aequorea victoria.
+
Aggregation Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
385 448 31,000 0.56 17.36      

Photostability

no photostability measurements available ... add one!

oxBFP Sequence

oxBFP was derived from EBFP2 with the following mutations: C48S/C70V/V163A
amino acid numbers relative to avGFP. show relative to EBFP2

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFISTTGKLPVPWPTLVTTLSHGVQVFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGTYKTRAEVKFEGDTLVNRIELKGVDFKEDGNILGHKLEYNFNSHNIYIMAVKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSVLSKDPNEKRDHMVLLEFRTAAGITLGMDELYK

Excerpts

We found that [adding F99S and V163A to EBFP2] did not prevent oligomer formation, but we observed a significant reduction in the proportion of covalent oligomers compared with monomeric species... Therefore, it appeared that we would need to mutate the two FP cysteine residues (C48 and 70). However, mutagenesis of the cysteines in the closely related EGFP decreased brightness with single cysteine mutations and rendered the protein dark upon mutating both cysteines... In an attempt to restore fluorescence, we turned our attention to the missing F99S and V163A cycle-3 mutations. Additional rounds of mutagenesis revealed that the combination of C48S, C70S and V163A resulted in a BFP with brightness comparable to parental EBFP2, without the problematic cysteine residues

Costantini et al. (2015)

The new BFP, termed oxBFP, is fluorescent within the cytoplasm and lumen of the ER and does not participate in non-native disulphide bonds

Costantini et al. (2015)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change