compare

Comparison List

NowGFP

NowGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2015, derived from Aequorea victoria. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.7 kDa -

FPbase ID: HXP5A

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
494 502 56,700 0.76 43.09 6.2   5.1

Photostability

No photostability measurements available ... add one!

NowGFP Sequence

NowGFP was derived from WasCFP with the following mutations: E6K/L42M/T43S/V68M/I128V/V150A/N164Y/K166T/N170D/I171V/Q177L/T230P/M233A
amino acid numbers relative to avGFP. show relative to WasCFP

MVSKGEKLFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKMSLKFICTTGKLPVPWPTLKTTLTWGMQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGVDFKEDGNILGHKLEYNAISGNANITADKQKNGIKAYFTIRHDVEDGSVLLADHYQQNTPIGDGPVLLPDNHYLSTQSKQSKDPNEKRDHMVLLEFVTAAGIPLGADELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for NowGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Structure of the green fluorescent protein NowGFP with an anionic tryptophan-based chromophore

    Pletnev Vz, Pletneva Nv, Sarkisyan Ks, Mishin As, Lukyanov Ka, Goryacheva Ea, Ziganshin Rh, Dauter Z, Pletnev S

    (2015). Acta Crystallographica Section D Biological Crystallography, 71(8) , 1699-1707. doi: 10.1107/s1399004715010159. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change